Ap1s1 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2259340
Artikelname: |
Ap1s1 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2259340 |
Hersteller Artikelnummer: |
orb2259340 |
Alternativnummer: |
BYT-ORB2259340-25 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Mouse |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ap1s1 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
AP, AP19 |
Ap1s1 Antibody - C-terminal region |
Klonalität: |
Polyclonal |
Molekulargewicht: |
19kDa |
NCBI: |
031483 |
UniProt: |
P61967 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES |