ATG16L2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2262253
Artikelname: |
ATG16L2 Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2262253 |
Hersteller Artikelnummer: |
orb2262253 |
Alternativnummer: |
BYT-ORB2262253-25 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L2 |
Konjugation: |
Unconjugated |
Alternative Synonym: |
WDR80, ATG16B |
ATG16L2 Antibody - middle region |
Klonalität: |
Polyclonal |
Molekulargewicht: |
56kDa |
NCBI: |
005274435 |
UniProt: |
Q8NAA4 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: SASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLP |