TLR8 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2262259
| Artikelname: |
TLR8 Antibody - C-terminal region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2262259 |
| Hersteller Artikelnummer: |
orb2262259 |
| Alternativnummer: |
BYT-ORB2262259-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human TLR8 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CD288 |
| TLR8 Antibody - C-terminal region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
120kDa |
| NCBI: |
619542 |
| UniProt: |
Q9NR97 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSR |
