OGDH Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2262424
Artikelname: OGDH Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2262424
Hersteller Artikelnummer: orb2262424
Alternativnummer: BYT-ORB2262424-25
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDH
Konjugation: Unconjugated
Alternative Synonym: E1k, KGD1, OGDC, AKGDH, OGDH2
OGDH Antibody - N-terminal region
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 001003941
UniProt: Q96DD3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL