NT5C1B Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2262425
| Artikelname: |
NT5C1B Antibody - N-terminal region, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2262425 |
| Hersteller Artikelnummer: |
orb2262425 |
| Alternativnummer: |
BYT-ORB2262425-25 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
AIRP, CN1B, CN-IB |
| NT5C1B Antibody - N-terminal region |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
61kDa |
| NCBI: |
150278 |
| UniProt: |
B7ZVX7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT |
