CALR Antibody - middle region, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2262669
Artikelname: |
CALR Antibody - middle region, Unconjugated, Rabbit, Polyclonal |
Artikelnummer: |
BYT-ORB2262669 |
Hersteller Artikelnummer: |
orb2262669 |
Alternativnummer: |
BYT-ORB2262669-25 |
Hersteller: |
Biorbyt |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CALR |
Konjugation: |
Unconjugated |
Alternative Synonym: |
RO, CRT, SSA, cC1qR, HEL-S-99n |
CALR Antibody - middle region |
Klonalität: |
Polyclonal |
Molekulargewicht: |
46kDa |
NCBI: |
004334 |
UniProt: |
P27797 |
Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequenz: |
Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT |