Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1), partial, Biotinylated (Active)

Artikelnummer: BYT-ORB2280207
Artikelname: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1), partial, Biotinylated (Active)
Artikelnummer: BYT-ORB2280207
Hersteller Artikelnummer: orb2280207
Alternativnummer: BYT-ORB2280207-20,BYT-ORB2280207-100,BYT-ORB2280207-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: BGP, BGP1
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1), partial, Biotinylated (Active)
Molekulargewicht: 48.2 kDa
UniProt: P13688
Puffer: Lyophilized powder
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM1 at 2 µg/mL can bind Anti-CEACAM1 recombinant antibody. The EC50 is 3.432 - 6.079 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM1 at 2 µg/ml can bind Anti-CEACAM1 recombinant antibody. The EC50 is 3.432 - 6.079 ng/mL.