Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1(SLC39A6), partial (Active)

Artikelnummer: BYT-ORB2280217
Artikelname: Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1(SLC39A6), partial (Active)
Artikelnummer: BYT-ORB2280217
Hersteller Artikelnummer: orb2280217
Alternativnummer: BYT-ORB2280217-20,BYT-ORB2280217-100,BYT-ORB2280217-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Recombinant Macaca fascicularis Zinc transporter ZIP6 isoform X1(SLC39A6), partial (Active)
Molekulargewicht: 33.6 kDa
Puffer: Lyophilized powder
Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNY
Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 µg/mL can bind Anti-SLC39A6 recombinant antibody. The EC50 is 0.8290-0.9864 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 µg/ml can bind Anti-SLC39A6 recombinant antibody. The EC50 is 0.8290-0.9864 ng/mL.