Recombinant Human Beta-2 adrenergic receptor(ADRB2)(G16R,E27Q)-VLPs

Artikelnummer: BYT-ORB2280231
Artikelname: Recombinant Human Beta-2 adrenergic receptor(ADRB2)(G16R,E27Q)-VLPs
Artikelnummer: BYT-ORB2280231
Hersteller Artikelnummer: orb2280231
Alternativnummer: BYT-ORB2280231-20,BYT-ORB2280231-100,BYT-ORB2280231-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-2 adrenoreceptor,Beta-2 adrenoceptor
Recombinant Human Beta-2 adrenergic receptor(ADRB2)(G16R,E27Q)-VLPs
Molekulargewicht: 47.8 kDa
UniProt: P07550
Puffer: Lyophilized powder
Quelle: Homo sapiens (Human)
Reinheit: The purity information is not available for VLPs proteins.
Formulierung: Lyophilized powder
Sequenz: MGQPGNGSAFLLAPNGSHAPDHDVTQERDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by SEC-HPLC