Mouse Aif1 protein

Artikelnummer: BYT-ORB244008
Artikelname: Mouse Aif1 protein
Artikelnummer: BYT-ORB244008
Hersteller Artikelnummer: orb244008
Alternativnummer: BYT-ORB244008-1,BYT-ORB244008-100,BYT-ORB244008-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Aif1
This Mouse Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 20.8 kDa
UniProt: O70200
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of His-tag and expression region is 2-147aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Aif1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Aif1.