Mouse Cd74 protein

Artikelnummer: BYT-ORB244092
Artikelname: Mouse Cd74 protein
Artikelnummer: BYT-ORB244092
Hersteller Artikelnummer: orb244092
Alternativnummer: BYT-ORB244092-20,BYT-ORB244092-100,BYT-ORB244092-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cd74
This Mouse Cd74 protein spans the amino acid sequence from region 56-279aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 29.4 kDa
UniProt: P04441
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular domain of His-tag and expression region is 56-279aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cd74.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cd74.