Mouse Cd74 protein
Artikelnummer:
BYT-ORB244092
- Bilder (3)
| Artikelname: | Mouse Cd74 protein |
| Artikelnummer: | BYT-ORB244092 |
| Hersteller Artikelnummer: | orb244092 |
| Alternativnummer: | BYT-ORB244092-20,BYT-ORB244092-100,BYT-ORB244092-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cd74 |
| This Mouse Cd74 protein spans the amino acid sequence from region 56-279aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 29.4 kDa |
| UniProt: | P04441 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular domain of His-tag and expression region is 56-279aa |



