Human IDO protein

Artikelnummer: BYT-ORB244288
Artikelname: Human IDO protein
Artikelnummer: BYT-ORB244288
Hersteller Artikelnummer: orb244288
Alternativnummer: BYT-ORB244288-1,BYT-ORB244288-100,BYT-ORB244288-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Indoleamine 2, 3-dioxygenase 1 protein, IDO-1 protein, Indoleamine-pyrrole 2,3-dioxygenase protein, IDO protein, INDO protein, IDO1 protein
This Human IDO protein spans the amino acid sequence from region 1-403aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.3 kDa
UniProt: P14902
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWED
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag and expression region is 1-403aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IDO1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IDO1.