Human JAK2 protein
Artikelnummer:
BYT-ORB244313
- Bilder (3)
| Artikelname: | Human JAK2 protein |
| Artikelnummer: | BYT-ORB244313 |
| Hersteller Artikelnummer: | orb244313 |
| Alternativnummer: | BYT-ORB244313-20,BYT-ORB244313-100,BYT-ORB244313-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | JAK2 |
| This Human JAK2 protein spans the amino acid sequence from region 752-1132aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 48.6 kDa |
| UniProt: | O60674 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | KPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKE |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Partial of the full length of 1-1132aa of His-tag and expression region is 752-1132aa |



