Viral NP protein

Produktübersicht

• Artikelname: Viral NP protein
• Artikelnummer: BYT-ORB244686
• Hersteller Artikelnummer: orb244686
• Alternativnummer: BYT-ORB244686-20,BYT-ORB244686-100,BYT-ORB244686-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: NP

Produktbeschreibung

This Viral NP protein spans the amino acid sequence from region 1-498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 72.2 kDa
• UniProt: P16980
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Influenza A virus (strain A/Equine/Prague/1/1956 H7N7)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASQGTKRPYEQMETGGERQNATEIRASVGKMVGGIGRFYIQMCTELKLNDYEGRLIQNSITIEKMVLSAFDERRNKYLEEHPNTGKDPKKTGGPIYRKREGKWIRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIED

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Influenza A virus (strain A/Equine/Prague/1/1956 H7N7). Application Notes: Full length of His-SUMO-tag and expression region is 1-498aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Equine/Prague/1/1956 H7N7) NP.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Equine/Prague/1/1956 H7N7) NP.