E.coli ptxA protein

Produktübersicht

• Artikelname: E.coli ptxA protein
• Artikelnummer: BYT-ORB244725
• Hersteller Artikelnummer: orb244725
• Alternativnummer: BYT-ORB244725-1,BYT-ORB244725-100,BYT-ORB244725-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ptxA

Produktbeschreibung

This E.coli ptxA protein spans the amino acid sequence from region 35-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 30.2 kDa
• UniProt: P04977
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.