E.coli ptxA protein

Artikelnummer: BYT-ORB244725
Artikelname: E.coli ptxA protein
Artikelnummer: BYT-ORB244725
Hersteller Artikelnummer: orb244725
Alternativnummer: BYT-ORB244725-20,BYT-ORB244725-100,BYT-ORB244725-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ptxA
This E.coli ptxA protein spans the amino acid sequence from region 35-269aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.2 kDa
UniProt: P04977
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Anwendungsbeschreibung: Biological Origin: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) ptxA.