E. coli fimH protein

Produktübersicht

• Artikelname: E. coli fimH protein
• Artikelnummer: BYT-ORB244754
• Hersteller Artikelnummer: orb244754
• Alternativnummer: BYT-ORB244754-1,BYT-ORB244754-100,BYT-ORB244754-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: fimH

Produktbeschreibung

This E. coli fimH protein spans the amino acid sequence from region 22-300aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 59.1 kDa
• UniProt: P08191
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli (strain K12)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTAN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is GST-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.