Human PLA2G2D protein

Artikelnummer: BYT-ORB244992
Artikelname: Human PLA2G2D protein
Artikelnummer: BYT-ORB244992
Hersteller Artikelnummer: orb244992
Alternativnummer: BYT-ORB244992-1,BYT-ORB244992-100,BYT-ORB244992-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: PLA2G2D
This Human PLA2G2D protein spans the amino acid sequence from region 22-145aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.5 kDa
UniProt: Q9UNK4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
SDS-PAGE analysis of using Human PLA2G2D protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.