E. coli recQ protein

Produktübersicht

• Artikelname: E. coli recQ protein
• Artikelnummer: BYT-ORB245697
• Hersteller Artikelnummer: orb245697
• Alternativnummer: BYT-ORB245697-20,BYT-ORB245697-100,BYT-ORB245697-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: recQ, b3822, JW5855

Produktbeschreibung

Recombinant E.coli ATP-dependent DNA helicase recQ

Produkteigenschaften

• Molekulargewicht: 71.9 kDa
• UniProt: P15043
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli (strain K12)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) recQ.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) recQ.