Human Dermcidin protein

Produktübersicht

• Artikelname: Human Dermcidin protein
• Artikelnummer: BYT-ORB245808
• Hersteller Artikelnummer: orb245808
• Alternativnummer: BYT-ORB245808-1,BYT-ORB245808-100,BYT-ORB245808-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: AIDD protein, DCD 1 protein, dcd protein, DCD-1 protein, DSEP protein, PIF protein, Preproteolysin protein

Produktbeschreibung

This Human Dermcidin protein spans the amino acid sequence from region 20-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 11.3 kDa
• UniProt: P81605
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DCD.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DCD.