Sheep IFNG protein

Artikelnummer: BYT-ORB245877
Artikelname: Sheep IFNG protein
Artikelnummer: BYT-ORB245877
Hersteller Artikelnummer: orb245877
Alternativnummer: BYT-ORB245877-1,BYT-ORB245877-100,BYT-ORB245877-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IFNG
This Sheep IFNG protein spans the amino acid sequence from region 24-166a. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.9 kDa
UniProt: P17773
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ovis aries (Sheep)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ovis aries (Sheep) IFNG.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ovis aries (Sheep) IFNG.