Human LY6G6D protein

Produktübersicht

• Artikelname: Human LY6G6D protein
• Artikelnummer: BYT-ORB245910
• Hersteller Artikelnummer: orb245910
• Alternativnummer: BYT-ORB245910-1,BYT-ORB245910-100,BYT-ORB245910-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: LY6G6D

Produktbeschreibung

This Human LY6G6D protein spans the amino acid sequence from region 20-104aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 11.1 kDa
• UniProt: O95868
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 µg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL. Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 µg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.