Mouse Thbs1 protein
Artikelnummer:
BYT-ORB246014
- Bilder (3)
| Artikelname: | Mouse Thbs1 protein |
| Artikelnummer: | BYT-ORB246014 |
| Hersteller Artikelnummer: | orb246014 |
| Alternativnummer: | BYT-ORB246014-1,BYT-ORB246014-100,BYT-ORB246014-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Thbs1 |
| This Mouse Thbs1 protein spans the amino acid sequence from region 19-350aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 38.6 kDa |
| UniProt: | Q80YQ1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFRIENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVVSNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGL |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein |



