Human E2 protein

Produktübersicht

• Artikelname: Human E2 protein
• Artikelnummer: BYT-ORB246114
• Hersteller Artikelnummer: orb246114
• Alternativnummer: BYT-ORB246114-1,BYT-ORB246114-100,BYT-ORB246114-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: E2

Produktbeschreibung

This Human E2 protein spans the amino acid sequence from region 1-365aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 43.3 kDa
• UniProt: P06790
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human papillomavirus type 18
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWENAIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSAYKTEDWTLQDTCEELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHRGLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLVKQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human papillomavirus type 18. Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Human papillomavirus type 18E2.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Human papillomavirus type 18E2.