E.coli botA protein

Produktübersicht

• Artikelname: E.coli botA protein
• Artikelnummer: BYT-ORB246249
• Hersteller Artikelnummer: orb246249
• Alternativnummer: BYT-ORB246249-1,BYT-ORB246249-100,BYT-ORB246249-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: botA

Produktbeschreibung

This E.coli botA protein spans the amino acid sequence from region 1-436aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 66 kDa
• UniProt: P0DPI0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Clostridium botulinum
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Clostridium botulinum. Application Notes: Full length of His-SUMO-tag and expression region is 1-436aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium botulinumbotA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium botulinumbotA.