Sheep TGFA protein

Produktübersicht

• Artikelname: Sheep TGFA protein
• Artikelnummer: BYT-ORB246450
• Hersteller Artikelnummer: orb246450
• Alternativnummer: BYT-ORB246450-1,BYT-ORB246450-100,BYT-ORB246450-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: TGFA

Produktbeschreibung

This Sheep TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 34.9 kDa
• UniProt: P98135
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Ovis aries (Sheep)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of Extracellular of GST-tag and expression region is 24-97aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) TGFA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) TGFA.