E.coli LMP1 protein

Produktübersicht

• Artikelname: E.coli LMP1 protein
• Artikelnummer: BYT-ORB246485
• Hersteller Artikelnummer: orb246485
• Alternativnummer: BYT-ORB246485-1,BYT-ORB246485-100,BYT-ORB246485-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: LMP1

Produktbeschreibung

This E.coli LMP1 protein spans the amino acid sequence from region 185-386aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 37 kDa
• UniProt: P13198
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4). Application Notes: Full length of Cytoplasmic of His-SUMO-tag and expression region is 185-386aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.