Human Capsid VP2 protein

Produktübersicht

• Artikelname: Human Capsid VP2 protein
• Artikelnummer: BYT-ORB246524
• Hersteller Artikelnummer: orb246524
• Alternativnummer: BYT-ORB246524-1,BYT-ORB246524-100,BYT-ORB246524-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Minor capsid protein VP1, EC 3.1.1.4, Coat protein VP1

Produktbeschreibung

This Human Capsid VP2 protein spans the amino acid sequence from region 228-781aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 64.8 kDa
• UniProt: P07299
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human parvovirus B19 (isolate AU) (HPV B19)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTSVNSAEASTGAGGGGSNSVKSMWSEGATFSANSVTCTFSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTISPIMGYSTPWRYLDFNALNLFFSPLEFQHLIENYGSIAPDALTVTISEIAVKDVTDKTGGGVQVTDSTTGRLCMLVDHEYKYPYVLGQGQDTLAPELPIWVYFPPQYAYLTVGDVNTQGISGDSKKLASEESAFYVLEHSSFQLLGTGGTASMSYKFPPVPPENLEGCSQHFYEMYNP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human parvovirus B19 (isolate AU) (HPV B19). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human parvovirus B19 (isolate AU) (HPV B19).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human parvovirus B19 (isolate AU) (HPV B19).