Yeast neurotoxin type E protein

Artikelnummer: BYT-ORB246821
Artikelname: Yeast neurotoxin type E protein
Artikelnummer: BYT-ORB246821
Hersteller Artikelnummer: orb246821
Alternativnummer: BYT-ORB246821-1,BYT-ORB246821-100,BYT-ORB246821-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Botulinum neurotoxin type E, BoNT/E, Bontoxilysin-E) [Cleaved into, Botulinum neurotoxin E light chain, LC, EC 3.4.24.69), Botulinum neurotoxin E heavy chain, HC)]
This Yeast neurotoxin type E protein spans the amino acid sequence from region 2-422aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.7 kDa
UniProt: P30995
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Clostridium butyricum
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFG
Anwendungsbeschreibung: Biological Origin: Clostridium butyricum. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Clostridium butyricum.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Clostridium butyricum.