Yeast mutS protein

Produktübersicht

• Artikelname: Yeast mutS protein
• Artikelnummer: BYT-ORB246846
• Hersteller Artikelnummer: orb246846
• Alternativnummer: BYT-ORB246846-1,BYT-ORB246846-100,BYT-ORB246846-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: mutS

Produktbeschreibung

This Yeast mutS protein spans the amino acid sequence from region 1-859aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 100.4 kDa
• UniProt: O66652
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Aquifex aeolicus (strain VF5)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEKSEKELTPMLSQYHYFKNQYPDCLLLFRLGDFYELFYEDAYIGSKELGLVLTSRPAGKGKERIPMCGVPYHSANSYIAKLVNKGYKVAICEQVEDPSKAKGIVKREVVRVITPGTFFERDTGGLASLYKKGNHYYVGYLNLAVGEFLGAKVKIEELLDLLSKLNIKEILVKKGEKLPEELEKVLKVYVSELEEEFFEEGSEEILKDFGVLSLQAFGFEEDTYSLPLGAVYKYAKTTQKGYTPLIPRPKPYRDE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Aquifex aeolicus (strain VF5). Application Notes: This is His-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Aquifex aeolicus (strain VF5) mutS.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Aquifex aeolicus (strain VF5) mutS.