Human ppsA protein

Produktübersicht

• Artikelname: Human ppsA protein
• Artikelnummer: BYT-ORB246895
• Hersteller Artikelnummer: orb246895
• Alternativnummer: BYT-ORB246895-1,BYT-ORB246895-100,BYT-ORB246895-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ppsA

Produktbeschreibung

This Human ppsA protein spans the amino acid sequence from region 2-792aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 103.3 kDa
• UniProt: P23538
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli (strain K12)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SNNGSSPLVLWYNQLGMNDVDRVGGKNASLGEMITNLSGMGVSVPNGFATTADAFNQFLDQSGVNQRIYELLDKTDIDDVTQLAKAGAQIRQWIIDTPFQPELENAIREAYAQLSADDENASFAVRSSATAEDMPDASFAGQQETFLNVQGFDAVLVAVKHVFASLFNDRAISYRVHQGYDHRGVALSAGVQRMVRSDLASSGVMFSIDTESGFDQVVFITSAWGLGEMVVQGAVNPDEFYVHKPTLAANRPAIV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Full length of His-SUMO-tag and expression region is 2-792aa

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ppsA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ppsA.