SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (PE)
Artikelnummer:
BYT-ORB2602824
| Artikelname: |
SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (PE) |
| Artikelnummer: |
BYT-ORB2602824 |
| Hersteller Artikelnummer: |
orb2602824 |
| Alternativnummer: |
BYT-ORB2602824-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
FC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Konjugation: |
PE |
| Alternative Synonym: |
ORF8 protein, ORF8, Non-structural protein 8, ns8, sars-cov-2 |
| Anti-SARS-CoV-2 ORF8 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
16693 Da |
| UniProt: |
P0DTC8 |
| Puffer: |
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Formulierung: |
Liquid |
| Target-Kategorie: |
ORF8 protein |
| Application Verdünnung: |
Flow Cytometry, Optimal dilutions should be determined by end users. |
