SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (Biotin)

Artikelnummer: BYT-ORB2602829
Artikelname: SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (Biotin)
Artikelnummer: BYT-ORB2602829
Hersteller Artikelnummer: orb2602829
Alternativnummer: BYT-ORB2602829-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Spezies Reaktivität: Human
Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Konjugation: Biotin
Alternative Synonym: ORF8 protein, ORF8, Non-structural protein 8, ns8, sars-cov-2
Anti-SARS-CoV-2 ORF8 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Molekulargewicht: 16693 Da
UniProt: P0DTC8
Puffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Formulierung: Liquid
Target-Kategorie: ORF8 protein
Application Verdünnung: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.