Anti-SARS-CoV-2 NSP9 Antibody, iFluor647, Rabbit, Polyclonal

Artikelnummer: BYT-ORB2602837
Artikelname: Anti-SARS-CoV-2 NSP9 Antibody, iFluor647, Rabbit, Polyclonal
Artikelnummer: BYT-ORB2602837
Hersteller Artikelnummer: orb2602837
Alternativnummer: BYT-ORB2602837-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Konjugation: iFluor647
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9
Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTD1
Formulierung: Lyophilized
Anwendungsbeschreibung: Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml