SARS-CoV-2 NSP9 Antibody, APC, Rabbit, Polyclonal
Artikelnummer:
BYT-ORB2602839
| Artikelname: |
SARS-CoV-2 NSP9 Antibody, APC, Rabbit, Polyclonal |
| Artikelnummer: |
BYT-ORB2602839 |
| Hersteller Artikelnummer: |
orb2602839 |
| Alternativnummer: |
BYT-ORB2602839-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA |
| Spezies Reaktivität: |
Human |
| Immunogen: |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Konjugation: |
APC |
| Alternative Synonym: |
Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9, sars-cov-2 |
| Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human. |
| Klonalität: |
Polyclonal |
| Konzentration: |
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Molekulargewicht: |
140 kDa, 130 kDa, 110 kDa |
| UniProt: |
P0DTD1 |
| Formulierung: |
Lyophilized |
| Anwendungsbeschreibung: |
Application Notes: ELISA, 0.001-0.1µg/ml, Human. Add 0.2ml of distilled water will yield a concentration of 500ug/ml |