SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody (Biotin)

Produktübersicht

• Artikelname: SARS-CoV-2 NSP9/SARS Rabbit Polyclonal Antibody (Biotin)
• Artikelnummer: BYT-ORB2602843
• Hersteller Artikelnummer: orb2602843
• Alternativnummer: BYT-ORB2602843-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC, WB
• Spezies Reaktivität: Human
• Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Konjugation: Biotin
• Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2

Produktbeschreibung

Anti-SARS-CoV-2 NSP9 Antibody. Tested in ELISA applications. This antibody reacts with Human.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 16693 Da
• UniProt: P0DTD1
• Puffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
• Formulierung: Liquid
• Target-Kategorie: P2X purinoceptor 1

Anwendungsbeschreibung

• Application Verdünnung: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.