Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated

Artikelnummer: BYT-ORB2658567
Artikelname: Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated
Artikelnummer: BYT-ORB2658567
Hersteller Artikelnummer: orb2658567
Alternativnummer: BYT-ORB2658567-20,BYT-ORB2658567-100,BYT-ORB2658567-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Finegoldia magna ATCC 53516 LPXTG-motif cell wall anchor domain protein, partial, Biotinylated spans the amino acid sequence from region 106-470aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 86.4 kDa
UniProt: D6S9W1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Finegoldia magna ATCC 53516
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFA
Anwendungsbeschreibung: Biological Origin: Finegoldia magna ATCC 53516. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized anti-CTLA4 antibody at 2 µg/ml can bind Biotinylated Protein L. The EC50 is 1.123-1.761 ng/mL.
The purity of Protein L was greater than 95% as determined by SEC-HPLC