Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)
Artikelnummer:
BYT-ORB2658855
- Bilder (3)
| Artikelname: | Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active) |
| Artikelnummer: | BYT-ORB2658855 |
| Hersteller Artikelnummer: | orb2658855 |
| Alternativnummer: | BYT-ORB2658855-20,BYT-ORB2658855-100,BYT-ORB2658855-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | IL-15 receptor subunit alpha, IL-15R-alpha, IL-15RA |
| This Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active) spans the amino acid sequence from region 31-205aa. Purity: Greater than 95% as determined by SDS-PAGE. |
| Molekulargewicht: | 19.9 kDa |
| UniProt: | Q13261 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 95% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IL15RA at 2 µg/mL can bind Human IL15. The EC50 is 32.53-38.41 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



