Recombinant Macaca fascicularis CD276 molecule (CD276), partial (Active)

Produktübersicht

• Artikelname: Recombinant Macaca fascicularis CD276 molecule (CD276), partial (Active)
• Artikelnummer: BYT-ORB2659154
• Hersteller Artikelnummer: orb2659154
• Alternativnummer: BYT-ORB2659154-20,BYT-ORB2659154-100,BYT-ORB2659154-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide

Produktbeschreibung

This Recombinant Macaca fascicularis CD276 molecule(CD276), partial (Active) spans the amino acid sequence from region 29-465aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 48.4 kDa
• UniProt: A0A7N9CYV2
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 µg/mL can bind Anti-CD276 recombinant antibody. The EC50 is 4.299-5.373 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 µg/ml can bind Anti-CD276 recombinant antibody. The EC50 is 4.299-5.373 ng/mL.

The purity of CD276 was greater than 90% as determined by SEC-HPLC