Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active)

Artikelnummer: BYT-ORB2659514
Artikelname: Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active)
Artikelnummer: BYT-ORB2659514
Hersteller Artikelnummer: orb2659514
Alternativnummer: BYT-ORB2659514-20,BYT-ORB2659514-100,BYT-ORB2659514-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active) spans the amino acid sequence from region 29-159aa(R127A,R130A). Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 16.6 kDa
UniProt: Q969D9
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human TSLP (R127A, R130A) at 2 µg/mL can bind Anti-TSLP recombinant antibody. The EC50 is 52.55-58.67 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Measured by its binding ability in a functional ELISA. Immobilized human TSLP (R127A, R130A) at 2 µg/ml can bind Anti-TSLP recombinant antibody. The EC50 is 52.55-58.67 ng/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of TSLP was greater than 95% as determined by SEC-HPLC