Recombinant Human Transcription factor AP-4 (TFAP4), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Transcription factor AP-4 (TFAP4), Biotinylated
• Artikelnummer: BYT-ORB3008833
• Hersteller Artikelnummer: orb3008833
• Alternativnummer: BYT-ORB3008833-1, BYT-ORB3008833-100, BYT-ORB3008833-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Transcription factor AP-4, Activating enhancer-binding protein 4, Class C basic helix-loop-helix protein 41, bHLHc41, TFAP4 BHLHC41

Produktbeschreibung

This Recombinant Human Transcription factor AP-4 (TFAP4), Biotinylated spans the amino acid sequence from region 1-338. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: Q01664
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGP

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)