Recombinant Human Tubulin alpha-3D chain (TBA3D), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Tubulin alpha-3D chain (TBA3D), Biotinylated
• Artikelnummer: BYT-ORB3008919
• Hersteller Artikelnummer: orb3008919
• Alternativnummer: BYT-ORB3008919-1, BYT-ORB3008919-100, BYT-ORB3008919-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Tubulin alpha-3D chain, EC 3.6.5.-, Alpha-tubulin 3D, [Cleaved into: Detyrosinated tubulin alpha-3D chain] TUBA3D

Produktbeschreibung

This Recombinant Human Tubulin alpha-3D chain (TBA3D), Biotinylated spans the amino acid sequence from region 1-450. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DPH8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)