Recombinant Human Golgin subfamily A member 6-like protein 25 (GG6LY), partial

Artikelnummer: BYT-ORB3009116
Artikelname: Recombinant Human Golgin subfamily A member 6-like protein 25 (GG6LY), partial
Artikelnummer: BYT-ORB3009116
Hersteller Artikelnummer: orb3009116
Alternativnummer: BYT-ORB3009116-1, BYT-ORB3009116-100, BYT-ORB3009116-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Golgin subfamily A member 6-like protein 25 GOLGA6L25
This Recombinant Human Golgin subfamily A member 6-like protein 25 (GG6LY), partial spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DX01
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MWPQPHLPTHPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)