Recombinant Human PRAME family member 15 (PRA15)

Artikelnummer: BYT-ORB3009130
Artikelname: Recombinant Human PRAME family member 15 (PRA15)
Artikelnummer: BYT-ORB3009130
Hersteller Artikelnummer: orb3009130
Alternativnummer: BYT-ORB3009130-1, BYT-ORB3009130-100, BYT-ORB3009130-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: PRAME family member 15 PRAMEF15
This Recombinant Human PRAME family member 15 (PRA15) spans the amino acid sequence from region 1-478. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DUQ1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQAWPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKLQVLDLQDVCENFWMVWSEAMAHGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLVLSHMDVSRYVSPEQK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)