Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082)

Artikelnummer: BYT-ORB3009175
Artikelname: Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082)
Artikelnummer: BYT-ORB3009175
Hersteller Artikelnummer: orb3009175
Alternativnummer: BYT-ORB3009175-1, BYT-ORB3009175-100, BYT-ORB3009175-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uncharacterized protein ZNF561-AS1, ZNF561 antisense RNA 1, ZNF561 antisense gene protein 1, ZNF561-AS1 C19orf82
This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082) spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: K7EIQ3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)