Recombinant Human Coiled-coil domain-containing protein 188 (CC188), partial

Produktübersicht

• Artikelname: Recombinant Human Coiled-coil domain-containing protein 188 (CC188), partial
• Artikelnummer: BYT-ORB3009179
• Hersteller Artikelnummer: orb3009179
• Alternativnummer: BYT-ORB3009179-1, BYT-ORB3009179-100, BYT-ORB3009179-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Coiled-coil domain-containing protein 188 CCDC188

Produktbeschreibung

This Recombinant Human Coiled-coil domain-containing protein 188 (CC188), partial spans the amino acid sequence from region 1-346. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: H7C350
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEGLKTLGPCGHPHPQCPPTPASSSHGGGLDQPCQGFVGWPCLGPISSAHSVQSQRPFPVPGAGGSGPTVEGEAPGLFLSSQEQRARDTEGPRQGDLEAGLGWGWPLHPGSNQGAPRQGGSIGSGTRPCPCPPLSREGGALASPRVALSQLQCGLLGSAEQSFLQLEQENHSLKRQNQELREQLGALLGPGQQFLPLCPEHSSCTALAWPPDPAGTQPLGNRAPLQLLRRELCQGQEAFVQQSQNELQQIRLCFE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)