Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

Artikelnummer: BYT-ORB3009184
Artikelname: Recombinant Human Coiled-coil domain-containing protein 179 (CC179)
Artikelnummer: BYT-ORB3009184
Hersteller Artikelnummer: orb3009184
Alternativnummer: BYT-ORB3009184-1, BYT-ORB3009184-100, BYT-ORB3009184-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Coiled-coil domain-containing protein 179 CCDC179
This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BU77
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)