Recombinant Human Transmembrane protein 178B (T178B), partial

Artikelnummer: BYT-ORB3009186
Artikelname: Recombinant Human Transmembrane protein 178B (T178B), partial
Artikelnummer: BYT-ORB3009186
Hersteller Artikelnummer: orb3009186
Alternativnummer: BYT-ORB3009186-1, BYT-ORB3009186-100, BYT-ORB3009186-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Transmembrane protein 178B TMEM178B
This Recombinant Human Transmembrane protein 178B (T178B), partial spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BS89
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)