Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142)

Artikelnummer: BYT-ORB3009225
Artikelname: Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142)
Artikelnummer: BYT-ORB3009225
Hersteller Artikelnummer: orb3009225
Alternativnummer: BYT-ORB3009225-1, BYT-ORB3009225-100, BYT-ORB3009225-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uncharacterized protein encoded by LINC02881, Long intergenic non-protein coding RNA 2881, LINC02881 C10orf142
This Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: B7Z368
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)