SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB3091646
Artikelname: SARS-CoV-2 NSP8/SARS Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB3091646
Hersteller Artikelnummer: orb3091646
Alternativnummer: BYT-ORB3091646-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Immunogen: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Konjugation: Unconjugated
Alternative Synonym: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp10, Non-structural protein 10, Growth factor-like peptide, GFL, rep, sars-cov-2
Anti-SARS-CoV-2 NSP8 Antibody. Tested in ELISA applications. This antibody reacts with Human.
Klonalität: Polyclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molekulargewicht: 140 kDa, 130 kDa, 110 kDa
UniProt: P0DTD1
Puffer: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Formulierung: Lyophilized
Target-Kategorie: Beta-2-microglobulin
Application Verdünnung: ELISA, 0.001-0.1µg/ml, Human