BARHL2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324396
Artikelname: BARHL2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324396
Hersteller Artikelnummer: orb324396
Alternativnummer: BYT-ORB324396-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BARHL2
Konjugation: Unconjugated
Rabbit polyclonal antibody to BARHL2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 42kDa
NCBI: 064447
UniProt: Q9NY43
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
Target-Kategorie: BARHL2